- TARS2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-82294
- Rabbit
- PBS (pH 7.2) and 40% Glycerol
- TARS2
- COXPD21, TARSL1, thrRS
- Unconjugated
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Human, Mouse, Rat
- 0.1 ml (also 25ul)
- This antibody was developed against Recombinant Protein corresponding to amino acids: HSSTHVLGAA AEQFLGAVLC RGPSTEYGFY HDFFLGKERT IRGSELPVLE RICQELTAAA RPFRRLEASR DQLRQLFKDN PFKLHLIE
- threonyl-tRNA synthetase 2, mitochondrial
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Endocrinology, Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
HSSTHVLGAAAEQFLGAVLCRGPSTEYGFYHDFFLGKERTIRGSELPVLERICQELTAAARPFRRLEASRDQLRQLFKDNPFKLHLIE
Specifications/Features
Available conjugates: Unconjugated